PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013594940.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 432aa    MW: 50582.7 Da    PI: 7.0552
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013594940.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.3e-18220266148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEd +l+++v+++G + W+ Ia+ ++ gR +kqc++rw+++l
   XP_013594940.1 220 KGQWTAEEDRILIQLVEKYGLRKWSHIAQVLP-GRIGKQCRERWHNHL 266
                      799*****************************.*************97 PP

2Myb_DNA-binding521.6e-16272314145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +  W++eEd  l++ +k+ G++ W+ Ia++++ gRt++++k++w+
   XP_013594940.1 272 KETWSEEEDRVLIEFHKEIGNK-WAEIAKRLP-GRTENSIKNHWN 314
                      578*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129430.067215270IPR017930Myb domain
SuperFamilySSF466891.33E-32218313IPR009057Homeodomain-like
SMARTSM007173.7E-18219268IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-26221270IPR009057Homeodomain-like
PfamPF139211.3E-20223280No hitNo description
CDDcd001672.21E-16223266No hitNo description
PROSITE profilePS5129421.16271321IPR017930Myb domain
SMARTSM007174.8E-16271319IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-22271319IPR009057Homeodomain-like
CDDcd001672.32E-12274317No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MENYVDESGF APLNQTIFAR DQEHMKEEDF PFEVVDQSKP TSFLQDFHHL DHDNQFDHHH  60
HHHHQYHGST SSNPLFGIQT TPSCANNAPY QHCSSYQENM VDFYETKPQV MNHHFQAVEN  120
PYLTRNHHQE INLVDDNDHM NLEQNNMMMM RMIPFDYPPT ETINKPMNFV MPDEVSCVSA  180
DNNSYRAMSF NKTKPFLTRK LSSSSSSSSW KGKKKTTLVK GQWTAEEDRI LIQLVEKYGL  240
RKWSHIAQVL PGRIGKQCRE RWHNHLRPDI KKETWSEEED RVLIEFHKEI GNKWAEIAKR  300
LPGRTENSIK NHWNATKRRQ FSKRKCRSKY PRPSLLQDYI KSLDVGVLSS SSVPARGRRK  360
ESSKKKDVVA AEEKKKEKEK EDKFYGQDRI VPECVFTDDF GFNEKLLEEG CSIDSLLDDL  420
PQPDMDAFVH GI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-452183212105MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-4421832156159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-4421832156159MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-452183212105C-Myb DNA-Binding Domain
1msf_C2e-452183212105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013594940.10.0PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L20.0MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A0D3A4700.0A0A0D3A470_BRAOL; Uncharacterized protein
STRINGBra013346.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58692847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.10.0myb domain protein 98